PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma114g00130.1
Common NameZOSMA_114G00130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 554aa    MW: 62615.8 Da    PI: 7.351
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma114g00130.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.6e-094054421954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gLt +qV++WF N R +
  Zosma114g00130.1 405 FEHflHPYPSDGDKHLLARQTGLTRNQVSNWFINARVR 442
                       664559******************************88 PP

2BELL111.45.2e-36266336272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       r e q++k+ Lls+l+eVd+rY+ y+eq+q++++sF+av++lg+akpYt lA+ka+SrhFrcLkd ++ q+
  Zosma114g00130.1 266 RFEQQRRKSGLLSMLDEVDRRYNYYCEQMQMIVNSFDAVMDLGAAKPYTGLAQKAMSRHFRCLKDGVIAQL 336
                       6799***************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-58193334IPR006563POX domain
PfamPF075261.6E-46198332IPR006563POX domain
PROSITE profilePS5007112.422383446IPR001356Homeobox domain
CDDcd000864.28E-11386447No hitNo description
SMARTSM003899.1E-9386450IPR001356Homeobox domain
SuperFamilySSF466894.28E-17387452IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-29389452IPR009057Homeodomain-like
PfamPF059201.1E-17403442IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSQGLHQGIF DFSDGFDRSR PSQTDHHQSE NITTTVYDPT ASGGNMLSEM FDFHHAGVAS  60
SATQLLTDQI SSGYYARLQQ RPPPMNSWNP NTVGMLMNPH HLQHQQQPTI CSSSPVDETQ  120
IPQALPLHHH HHHNFVNNHA PTLQVQGGLS LSLSSSMQQP FEIAKEETPA SSLYYNNINI  180
PLQQGQLGFN GQMGVLNILR HSKYAKAARE LLEEFCSVNR DDHDVKNRKG KRHRSDSSSI  240
PNQPANYCSS SSSKLQSEPN LSSSQRFEQQ RRKSGLLSML DEVDRRYNYY CEQMQMIVNS  300
FDAVMDLGAA KPYTGLAQKA MSRHFRCLKD GVIAQLKHTC EVLGDKDTGI TSGMTKGETP  360
RLKILDRNLR QQRSFNHMGM MEQETWRPQR GLPERSVNIL RAWLFEHFLH PYPSDGDKHL  420
LARQTGLTRN QVSNWFINAR VRLWKPMVEE MYLEESKENE DKEAEGETSS SSAAENKNHF  480
RHHHQFKSLP TEYPFGANNI SRSTVGAAEL QAPVFLNYGS QIRFGDPGDV SLTLGLQQSV  540
NMPAENNNNR FSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-17392450563Homeobox protein Meis2
3k2a_B6e-17392450563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395654.11e-143PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-121BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A0K9Q2880.0A0A0K9Q288_Z
STRINGGLYMA11G06640.21e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-121BEL1-like homeodomain 4